PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A00040.1.p
Common NameEUGRSUZ_A00040, LOC104416003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 931aa    MW: 102528 Da    PI: 5.2837
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A00040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.82.2e-28599650152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek++sl +l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Eucgr.A00040.1.p 599 AEKTVSLGVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 650
                       5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.733583670IPR003035RWP-RK domain
PfamPF020421.9E-25603650IPR003035RWP-RK domain
SuperFamilySSF542777.85E-23823914No hitNo description
Gene3DG3DSA:3.10.20.2401.9E-24827909No hitNo description
SMARTSM006663.9E-20830912IPR000270PB1 domain
PROSITE profilePS5174520.162830912IPR000270PB1 domain
PfamPF005642.5E-16831911IPR000270PB1 domain
CDDcd064071.95E-30831911No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 931 aa     Download sequence    Send to blast
MEYPFSSKEK GMGYWTPPGV QADSSASLDN GMRNSILEDP FVNFAELMNF EGYAGLCNSP  60
STTEQILAPY GLPISPSALY GSLDMMNFAE QSSFYHPDRG GVSNAVGSSY PFVDRLAFQQ  120
TDSQLDYQLD SNDQNDSGAK QGESALGRLG ISDVANNTIC RPLAFSLDEK MLRALSLFKD  180
YSGGGILAQV WVPIKHGDQY ILTTCEQPYL LDKMLEGYRE VSRTFTFSAE GKPGTFLGLP  240
GRVFTSKVPE WTSNVIYYNN SEYLRVKHAV HHNIRGSIAV PVFDSSDKSC CAVLELVTTK  300
EKANFDSEME KVCLALQAVN LRTTPPPRLL PQCLSRNQRD ALAEITDVLR AVCHAHRFPL  360
ALTWIPCCVS EGAADEIVRV RVRDGNGNAN EKCILCVEDT ACYVNDKEME GFVRACAEHY  420
LEEGQGIAGK ALQSNHPFFY PDVKNYDIHE YPLVHHARRF GLNAAVAIRL RSTFTGDDDY  480
ILEFFLPVNI KGSAEQQLLL DNLSRTMQRI CKTLRTVSDA ELFGTDGSKA ELQEVSLPSM  540
SPIPTYGGSH QTVLSDNSTS SIDGRPSNVP TSTRTVSDLP REQVTSLSRR QHEKKRSTAE  600
KTVSLGVLQQ YFSGSLKDAA KSIGVCPTTL KRICRQHGIS RWPSRKINKV NRSLKKIQTV  660
LNSVQGVEGG LKFDPNTGGF VAAGSIQEFD AQKNFIPDKK PAVQGEEASI EEEERSIPFV  720
CGNNSAIKLE DEYCVGGDHL GPSTASLHLL DISHEEAKKS SISQIEYRED SKSTAVDDGI  780
VEHDRPASSS MTDSSDGSGS IMHGSSSSSQ SFEEGKHSKE RTSSHDSGSK VTVKATYKDD  840
TIRFKFEPSD GCFQLYDEVS KRFKLQYGTF QLKYLDDEDE WVMLVSDSDL QECLEIMEYV  900
GTRSVKFLVR DVPAAMGSSG GSNCFLSGCS *
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A00040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028556.10.0PREDICTED: protein NLP8-like
RefseqXP_010027821.10.0PREDICTED: protein NLP8-like
RefseqXP_010027198.10.0PREDICTED: protein NLP8-like
RefseqXP_010026639.10.0PREDICTED: protein NLP8-like
RefseqXP_010026047.10.0PREDICTED: protein NLP8-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A059DB610.0A0A059DB61_EUCGR; Uncharacterized protein
STRINGPOPTR_0007s01530.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22992768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein